Pilidiostigmin, a novel bioactive dimeric acylphloroglucinol derivative isolated from Pilidiostigma glabrum
نویسندگان
چکیده
منابع مشابه
Pilidiostigmin, a novel bioactive dimeric acylphloroglucinol derivative isolated from Pilidiostigma glabrum
Pilidiostigmin, a novel dimeric acylphloroglucinol derivative, was isolated from the leaves of the Australian plant species Pilidiostigma glabrum (Myrtaceae). Pilidiostigmin exists in the plant in the form of a sodium salt, which is rare in natural products. The elucidation of the structure and relative configuration was achieved by spectroscopic measurements with special emphasis on 1D and 2D ...
متن کاملBioactive polyprenylated acylphloroglucinol derivatives from Hypericum cohaerens.
Nine new polyprenylated acylphloroglucinol derivatives, hypercohins B-J (1-9), and nine known analogues were isolated from the aerial parts of Hypericum cohaerens. The structures of 1-9 were elucidated based on spectroscopic analysis, and the absolute configuration of 1 was confirmed by X-ray crystallographic analysis. The inhibitory activities of these isolates on acetylcholinesterase and five...
متن کاملEffect of a novel stobadine derivative on isolated rat arteries
The antioxidant and reactive-oxygen-species-scavenging activity of stobadine has been demonstrated in previous studies. Recently, chemical modification of this leading structure led to the synthesis of other pyridoindole derivatives with significantly increased intrinsic antioxidant efficacy. Further structural modifications of stobadine provided the opportunity to increase bioavailability and ...
متن کاملA novel bioactive peptide from wasp venom
Wasp venoms contain a number of pharmacologically active biomolecules, undertaking a wide range of functions necessary for the wasp's survival. We purified and characterized a novel bioactive peptide (vespin) from the venoms of Vespa magnifica (Smith) wasps with unique primary structure. Its amino acid sequence was determined to be CYQRRVAITAGGLKHRLMSSLIIIIIIRINYLRDNSVIILESSY. It has 44 residue...
متن کاملAnti-inflammatory and anti-neuropathic effects of a novel quinic acid derivative from Acanthus syriacus
Objective: Acanthus syriacus (AS) is one of the valuable herbal plants with immunomodulatory potentials. The aim of this study is to assemble a phytochemical investigation of A. syriacus exploring its anti-inflammatory and antinociceptive properties...
متن کاملذخیره در منابع من
با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید
ژورنال
عنوان ژورنال: Tetrahedron Letters
سال: 2013
ISSN: 0040-4039
DOI: 10.1016/j.tetlet.2013.01.107